Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardenswildflowertropicalinsectsmeadow
Black Orchid from Orchid
Common Buttercup Flower from Buttercup
Caterpillar and Buttefly from Caterpillar
Rhododendron Calendulaceum or Flame Azalea from Azalea
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Orchids from Orchid
Anethum graveolens or Dill from Herb
Flower Poppy from Red
Hemerocallis Spp or Day Lily from Perennial
Europeana Floribunda Rose from Roses
Steampunk Bee from Steampunk animals coloring book
Bumblebee from Woodland animals
Butterfly from Cartoon animals viii coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Daffodil from Daffodil
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Cosmos Scabiosoides from Cosmos
Bee from Cartoon animals v coloring book
Swallow Tail Hummingbird from Hummingbirds
Apple Blossom Branch from Apple tree
Orchid Lycaste Aromatica from Orchid
Pollinators of Alaska from Nps
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Disa Kewensis Orchid from Orchid
Chrysanthemum 1 from Perennial
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Iris Flower Blossom from Iris
Double Delight Hybrid Tea Rose from Roses
Iris Motif from Iris
Black Elderberry from Elderberry
Bee from Cartoon animals viii coloring book
Heliconia Indica from Heliconia
Black Raspberry from Celebrating wildflowers coloring book
Spring Crocus from Crocus
Bug from Animals
Chinese Peony from Flowers
Common Fruit Bats from Realistic animals coloring book
Cherokee Rose from Roses
Hibiscus from Realistic flowers
Butterfly from Cartoon animals vii coloring book
Hibiscus Flower from Hawaii flower
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Renanthera Imschootiana Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Masdevallia Coccinea Orchid from Orchid
Saskatoon from Serviceberry
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
Bumblebee from Simple objects coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Bumblebee
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals viii coloring book
Ladybug from Cartoon animals v coloring book
Realistic Sunflowers from Sunflower
Hummingbird from Cartoon animals ii coloring book
Heliconia Psittacorum from Heliconia
Bluebell Bellflower from Bellflower
Aster or Star Plant from Asters
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Ranunculus Acris from Buttercup
Burke's Larkspur from Celebrating wildflowers coloring book
Butterfly Flies On A Flower from Flowers
Cornflower, Blue Bottle from Cornflowers
Scarlet Carnation from Carnation
Schlumbergera Bloom from Cactus
Cirsium Vulgare or Bull Thistle from Thistle
Aquilegia Truncata Red Columbine from Columbine
Viola Adunca or Pale Mountain Violet from Violet
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Oriental poppy from Perennial
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Clarkia Amoena Farewell to Spring from Godetia
Daffodil Flowers from Daffodil
Wildflower from Plants ii coloring book
Bug from Cartoon animals coloring book
Grasshopper on Flower from Grasshoppers
Aster 1 from Asters
Sophronitis Cernua Orchid from Orchid
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Common Evening Primrose or Evening Star from Primrose
Grasshopper in Garden from Grasshoppers
Sundowner Rosa Grandiflora from Roses
Tropical Vanda Tricolor Orchid from Orchid
Cornflower from Cornflowers
Big-Headed Clover from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Anemone Coronaria from Anemone
Pink Hibiscus from Realistic flowers
Chrysanthemum Carinatum from Realistic flowers
Life Cycle of Monarch Butterfly from Biology
Black Locust from Locust tree
Blooming Sunflower from Sunflower
Chrysanthemum Morifolium from Flower garden
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
201 - 300 of 1,830 Next page
/ 19